SERPINA12 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8074
- Images (1)
| Article Name: | SERPINA12 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8074 |
| Supplier Catalog Number: | A8074 |
| Alternative Catalog Number: | ABB-A8074-100UL,ABB-A8074-20UL,ABB-A8074-1000UL,ABB-A8074-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | OL-64, SERPINA12 |
| Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to act upstream of or within negative regulation of gluconeogenesis, positive regulation of signal transduction, and regulation of lipid metabolic process. Predicted to be located in plasma membrane. Predicted to be active in extracellular space. |
| Clonality: | Polyclonal |
| Molecular Weight: | 47kDa |
| NCBI: | 145264 |
| UniProt: | Q8IW75 |
| Purity: | Affinity purification |
| Sequence: | LLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFIL |
| Target: | SERPINA12 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Growth factors,Ubiquitin,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Neuroscience,Cardiovascular,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from mouse brain, using SERPINA12 Rabbit pAb (A8074) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
