ACRV1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8098
- Bilder (1)
| Artikelname: | ACRV1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8098 |
| Hersteller Artikelnummer: | A8098 |
| Alternativnummer: | ABB-A8098-20UL,ABB-A8098-100UL,ABB-A8098-500UL,ABB-A8098-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SP-10, SPACA2, D11S4365, ACRV1 |
| This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 28kDa |
| NCBI: | 56 |
| UniProt: | P26436 |
| Reinheit: | Affinity purification |
| Sequenz: | QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI |
| Target-Kategorie: | ACRV1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat testis, using ACRV1 Rabbit pAb (A8098) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
