ACRV1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8098
- Images (1)
| Article Name: | ACRV1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8098 |
| Supplier Catalog Number: | A8098 |
| Alternative Catalog Number: | ABB-A8098-20UL,ABB-A8098-100UL,ABB-A8098-500UL,ABB-A8098-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | SP-10, SPACA2, D11S4365, ACRV1 |
| This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described. |
| Clonality: | Polyclonal |
| Molecular Weight: | 28kDa |
| NCBI: | 56 |
| UniProt: | P26436 |
| Purity: | Affinity purification |
| Sequence: | QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI |
| Target: | ACRV1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat testis, using ACRV1 Rabbit pAb (A8098) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
