RGS20 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8167
- Bilder (1)
| Artikelname: | RGS20 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8167 |
| Hersteller Artikelnummer: | A8167 |
| Alternativnummer: | ABB-A8167-20UL,ABB-A8167-100UL,ABB-A8167-1000UL,ABB-A8167-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RGSZ1, ZGAP1, gz-GAP, g(z)GAP, RGS20 |
| The protein encoded by this gene belongs to the family of regulator of G protein signaling (RGS) proteins, which are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins inhibit signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound forms. This protein selectively binds to G(z)-alpha and G(alpha)-i2 subunits, and regulates their signaling activities. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 44kDa |
| NCBI: | 8601 |
| UniProt: | O76081 |
| Reinheit: | Affinity purification |
| Sequenz: | MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA |
| Target-Kategorie: | RGS20 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using RGS20 Rabbit pAb (A8167) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Produktgarantie und fachkundiger Support
