RGS20 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8167
- Images (1)
| Article Name: | RGS20 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8167 |
| Supplier Catalog Number: | A8167 |
| Alternative Catalog Number: | ABB-A8167-20UL,ABB-A8167-100UL,ABB-A8167-1000UL,ABB-A8167-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RGSZ1, ZGAP1, gz-GAP, g(z)GAP, RGS20 |
| The protein encoded by this gene belongs to the family of regulator of G protein signaling (RGS) proteins, which are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins inhibit signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound forms. This protein selectively binds to G(z)-alpha and G(alpha)-i2 subunits, and regulates their signaling activities. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 44kDa |
| NCBI: | 8601 |
| UniProt: | O76081 |
| Purity: | Affinity purification |
| Sequence: | MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA |
| Target: | RGS20 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using RGS20 Rabbit pAb (A8167) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Product Guarantee and Expert Support
