IL36A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8207
- Bilder (1)
| Artikelname: | IL36A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8207 |
| Hersteller Artikelnummer: | A8207 |
| Alternativnummer: | ABB-A8207-20UL,ABB-A8207-100UL,ABB-A8207-500UL,ABB-A8207-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FIL1, FIL1E, IL1F6, IL-1F6, IL1(EPSILON), FIL1(EPSILON), IL36A |
| The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 18kDa |
| NCBI: | 27179 |
| UniProt: | Q9UHA7 |
| Reinheit: | Affinity purification |
| Sequenz: | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
| Target-Kategorie: | IL36A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using IL36A Rabbit pAb (A8207) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
