IL36A Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8207
- Images (1)
| Article Name: | IL36A Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8207 |
| Supplier Catalog Number: | A8207 |
| Alternative Catalog Number: | ABB-A8207-20UL,ABB-A8207-100UL,ABB-A8207-500UL,ABB-A8207-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | FIL1, FIL1E, IL1F6, IL-1F6, IL1(EPSILON), FIL1(EPSILON), IL36A |
| The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. |
| Clonality: | Polyclonal |
| Molecular Weight: | 18kDa |
| NCBI: | 27179 |
| UniProt: | Q9UHA7 |
| Purity: | Affinity purification |
| Sequence: | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
| Target: | IL36A |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using IL36A Rabbit pAb (A8207) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
