SOST Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8213
Artikelname: SOST Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8213
Hersteller Artikelnummer: A8213
Alternativnummer: ABB-A8213-20UL,ABB-A8213-100UL,ABB-A8213-500UL,ABB-A8213-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CDD, VBCH, DAND6, SOST1, SOST
Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease.
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 50964
UniProt: Q9BQB4
Reinheit: Affinity purification
Sequenz: QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Target-Kategorie: SOST
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and293T cells transfected withSOST usingSOST Rabbit pAb (A8213) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:2s.