SOST Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8213
- Bilder (1)
| Artikelname: | SOST Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8213 |
| Hersteller Artikelnummer: | A8213 |
| Alternativnummer: | ABB-A8213-20UL,ABB-A8213-100UL,ABB-A8213-500UL,ABB-A8213-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CDD, VBCH, DAND6, SOST1, SOST |
| Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 24kDa |
| NCBI: | 50964 |
| UniProt: | Q9BQB4 |
| Reinheit: | Affinity purification |
| Sequenz: | QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY |
| Target-Kategorie: | SOST |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and293T cells transfected withSOST usingSOST Rabbit pAb (A8213) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:2s. |
Produktgarantie und fachkundiger Support
