SOST Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8213
- Images (1)
| Article Name: | SOST Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8213 |
| Supplier Catalog Number: | A8213 |
| Alternative Catalog Number: | ABB-A8213-20UL,ABB-A8213-100UL,ABB-A8213-500UL,ABB-A8213-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CDD, VBCH, DAND6, SOST1, SOST |
| Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease. |
| Clonality: | Polyclonal |
| Molecular Weight: | 24kDa |
| NCBI: | 50964 |
| UniProt: | Q9BQB4 |
| Purity: | Affinity purification |
| Sequence: | QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY |
| Target: | SOST |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and293T cells transfected withSOST usingSOST Rabbit pAb (A8213) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:2s. |
Product Guarantee and Expert Support
