SEMA4C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8225
Artikelname: SEMA4C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8225
Hersteller Artikelnummer: A8225
Alternativnummer: ABB-A8225-100UL,ABB-A8225-20UL,ABB-A8225-500UL,ABB-A8225-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SEMAF, SEMAI, SEMACL1, M-SEMA-F, SEMA4C
Predicted to enable chemorepellent activity and semaphorin receptor binding activity. Involved in muscle cell differentiation and positive regulation of stress-activated MAPK cascade. Located in extracellular space.
Klonalität: Polyclonal
Molekulargewicht: 93kDa
NCBI: 54910
UniProt: Q9C0C4
Reinheit: Affinity purification
Sequenz: HARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGGRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV
Target-Kategorie: SEMA4C
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using SEMA4C Rabbit pAb (A8225) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.