SEMA4C Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8225
Article Name: SEMA4C Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8225
Supplier Catalog Number: A8225
Alternative Catalog Number: ABB-A8225-100UL,ABB-A8225-20UL,ABB-A8225-500UL,ABB-A8225-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SEMAF, SEMAI, SEMACL1, M-SEMA-F, SEMA4C
Predicted to enable chemorepellent activity and semaphorin receptor binding activity. Involved in muscle cell differentiation and positive regulation of stress-activated MAPK cascade. Located in extracellular space.
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 54910
UniProt: Q9C0C4
Purity: Affinity purification
Sequence: HARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGGRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV
Target: SEMA4C
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using SEMA4C Rabbit pAb (A8225) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.