HS1BP3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8250
- Bilder (1)
| Artikelname: | HS1BP3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8250 |
| Hersteller Artikelnummer: | A8250 |
| Alternativnummer: | ABB-A8250-20UL,ABB-A8250-100UL,ABB-A8250-500UL,ABB-A8250-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ETM2, HS1-BP3, HS1BP3 |
| The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 43kDa |
| NCBI: | 64342 |
| UniProt: | Q53T59 |
| Reinheit: | Affinity purification |
| Sequenz: | MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEA |
| Target-Kategorie: | HS1BP3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using HS1BP3 Rabbit pAb (A8250) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Produktgarantie und fachkundiger Support
