HS1BP3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8250
Article Name: HS1BP3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8250
Supplier Catalog Number: A8250
Alternative Catalog Number: ABB-A8250-20UL,ABB-A8250-100UL,ABB-A8250-500UL,ABB-A8250-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ETM2, HS1-BP3, HS1BP3
The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 64342
UniProt: Q53T59
Purity: Affinity purification
Sequence: MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEA
Target: HS1BP3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using HS1BP3 Rabbit pAb (A8250) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.