SLCO1A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8452
Artikelname: SLCO1A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8452
Hersteller Artikelnummer: A8452
Alternativnummer: ABB-A8452-20UL,ABB-A8452-100UL,ABB-A8452-1000UL,ABB-A8452-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: OATP, OATP-A, OATP1A2, SLC21A3, SLCO1A2
This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. Alternative splicing of this gene results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 74kDa
NCBI: 6579
UniProt: P46721
Reinheit: Affinity purification
Sequenz: LLYFLSFLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDI
Target-Kategorie: SLCO1A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Immunology Inflammation,Cytokines. Shipping: Ice Bag
Western blot analysis of lysates from Rat liver, using SLCO1A2 Rabbit pAb (A8452) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.