SLCO1A2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8452
- Images (1)
| Article Name: | SLCO1A2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8452 |
| Supplier Catalog Number: | A8452 |
| Alternative Catalog Number: | ABB-A8452-20UL,ABB-A8452-100UL,ABB-A8452-1000UL,ABB-A8452-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | OATP, OATP-A, OATP1A2, SLC21A3, SLCO1A2 |
| This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. Alternative splicing of this gene results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 74kDa |
| NCBI: | 6579 |
| UniProt: | P46721 |
| Purity: | Affinity purification |
| Sequence: | LLYFLSFLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDI |
| Target: | SLCO1A2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Immunology Inflammation,Cytokines. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat liver, using SLCO1A2 Rabbit pAb (A8452) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
