TIMM17B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8477
- Bilder (1)
| Artikelname: | TIMM17B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8477 |
| Hersteller Artikelnummer: | A8477 |
| Alternativnummer: | ABB-A8477-20UL,ABB-A8477-100UL,ABB-A8477-1000UL,ABB-A8477-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | JM3, TIM17B, DXS9822, TIMM17B |
| This gene encodes a multipass transmembrane protein that forms an integral component of the mitochondrial translocase TIM23 complex. This complex facilitates the transport of mitochondrial proteins from the cytosol across the mitochondrial inner membrane and into the mitochondrion. There is a pseudogene for this gene on chromosome 12. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 18kDa |
| NCBI: | 10245 |
| UniProt: | O60830 |
| Reinheit: | Affinity purification |
| Sequenz: | MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH |
| Target-Kategorie: | TIMM17B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag |

