TIMM17B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8477
Article Name: TIMM17B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8477
Supplier Catalog Number: A8477
Alternative Catalog Number: ABB-A8477-20UL,ABB-A8477-100UL,ABB-A8477-1000UL,ABB-A8477-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: JM3, TIM17B, DXS9822, TIMM17B
This gene encodes a multipass transmembrane protein that forms an integral component of the mitochondrial translocase TIM23 complex. This complex facilitates the transport of mitochondrial proteins from the cytosol across the mitochondrial inner membrane and into the mitochondrion. There is a pseudogene for this gene on chromosome 12. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 10245
UniProt: O60830
Purity: Affinity purification
Sequence: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
Target: TIMM17B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of lysates from mouse heart, using TIMM17B Rabbit pAb (A8477) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.