MARVELD2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8909
Artikelname: MARVELD2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8909
Hersteller Artikelnummer: A8909
Alternativnummer: ABB-A8909-100UL,ABB-A8909-20UL,ABB-A8909-500UL,ABB-A8909-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Tric, DFNB49, MARVD2, MRVLDC2, MARVELD2
The protein encoded by this gene is a membrane protein found at the tight junctions between epithelial cells. The encoded protein helps establish epithelial barriers such as those in the organ of Corti, where these barriers are required for normal hearing. Defects in this gene are a cause of deafness autosomal recessive type 49 (DFNB49). Two transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 153562
UniProt: Q8N4S9
Reinheit: Affinity purification
Sequenz: ELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
Target-Kategorie: MARVELD2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Adhesion,Tight Junctions,Cytoskeleton. Shipping: Ice Bag
Western blot analysis of lysates from SH-SY5Y cells, using MARVELD2 Rabbit pAb (A8909) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.