MARVELD2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8909
Article Name: MARVELD2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8909
Supplier Catalog Number: A8909
Alternative Catalog Number: ABB-A8909-100UL,ABB-A8909-20UL,ABB-A8909-500UL,ABB-A8909-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Tric, DFNB49, MARVD2, MRVLDC2, MARVELD2
The protein encoded by this gene is a membrane protein found at the tight junctions between epithelial cells. The encoded protein helps establish epithelial barriers such as those in the organ of Corti, where these barriers are required for normal hearing. Defects in this gene are a cause of deafness autosomal recessive type 49 (DFNB49). Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 153562
UniProt: Q8N4S9
Purity: Affinity purification
Sequence: ELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
Target: MARVELD2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Adhesion,Tight Junctions,Cytoskeleton. Shipping: Ice Bag
Western blot analysis of lysates from SH-SY5Y cells, using MARVELD2 Rabbit pAb (A8909) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.