POMP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9067
- Bilder (1)
| Artikelname: | POMP Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9067 |
| Hersteller Artikelnummer: | A9067 |
| Alternativnummer: | ABB-A9067-20UL,ABB-A9067-100UL,ABB-A9067-1000UL,ABB-A9067-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | UMP1, PRAAS2, HSPC014, C13orf12, PNAS-110, POMP |
| The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5 UTR of this gene has been associated with KLICK syndrome, a rare skin disorder. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 16kDa |
| NCBI: | 51371 |
| UniProt: | Q9Y244 |
| Reinheit: | Affinity purification |
| Sequenz: | MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL |
| Target-Kategorie: | POMP |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology. Shipping: Ice Bag |

