POMP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9067
Article Name: POMP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9067
Supplier Catalog Number: A9067
Alternative Catalog Number: ABB-A9067-20UL,ABB-A9067-100UL,ABB-A9067-1000UL,ABB-A9067-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: UMP1, PRAAS2, HSPC014, C13orf12, PNAS-110, POMP
The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5 UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 51371
UniProt: Q9Y244
Purity: Affinity purification
Sequence: MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL
Target: POMP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using POMP Rabbit pAb (A9067) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.