GLOD4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9216
Artikelname: GLOD4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9216
Hersteller Artikelnummer: A9216
Alternativnummer: ABB-A9216-20UL,ABB-A9216-100UL,ABB-A9216-1000UL,ABB-A9216-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HC6, HC71, CGI-150, C17orf25, GLOD4
Enables cadherin binding activity. Located in extracellular exosome.
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 51031
UniProt: Q9HC38
Reinheit: Affinity purification
Sequenz: DNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
Target-Kategorie: GLOD4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using GLOD4 Rabbit pAb (A9216) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.