GLOD4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9216
Article Name: GLOD4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9216
Supplier Catalog Number: A9216
Alternative Catalog Number: ABB-A9216-20UL,ABB-A9216-100UL,ABB-A9216-1000UL,ABB-A9216-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HC6, HC71, CGI-150, C17orf25, GLOD4
Enables cadherin binding activity. Located in extracellular exosome.
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 51031
UniProt: Q9HC38
Purity: Affinity purification
Sequence: DNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
Target: GLOD4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using GLOD4 Rabbit pAb (A9216) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.