ROGDI Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9239
Artikelname: ROGDI Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9239
Hersteller Artikelnummer: A9239
Alternativnummer: ABB-A9239-20UL,ABB-A9239-100UL,ABB-A9239-500UL,ABB-A9239-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KTZS, RAV2, ROGD1, ROGDI
Involved in brain development, neurogenesis, and odontogenesis of dentin-containing tooth. Located in nuclear envelope. Implicated in Kohlschutter-Tonz syndrome.
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 79641
UniProt: Q9GZN7
Reinheit: Affinity purification
Sequenz: MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGA
Target-Kategorie: ROGDI
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Kinase,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag
Western blot analysis of various lysates using ROGDI Rabbit pAb (A9239) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.