ROGDI Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9239
Article Name: ROGDI Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9239
Supplier Catalog Number: A9239
Alternative Catalog Number: ABB-A9239-20UL,ABB-A9239-100UL,ABB-A9239-500UL,ABB-A9239-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KTZS, RAV2, ROGD1, ROGDI
Involved in brain development, neurogenesis, and odontogenesis of dentin-containing tooth. Located in nuclear envelope. Implicated in Kohlschutter-Tonz syndrome.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 79641
UniProt: Q9GZN7
Purity: Affinity purification
Sequence: MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGA
Target: ROGDI
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Kinase,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag
Western blot analysis of various lysates using ROGDI Rabbit pAb (A9239) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.