Hemoglobin subunit alpha (HBA1) Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A9293
Artikelname: Hemoglobin subunit alpha (HBA1) Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A9293
Hersteller Artikelnummer: A9293
Alternativnummer: ABB-A9293-100UL,ABB-A9293-20UL,ABB-A9293-1000UL,ABB-A9293-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HBH, ECYT7, HBA-T3, METHBA, Hemoglobin subunit alpha (HBA1)
The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5 untranslated regions and the introns, but they differ significantly over the 3 untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin, alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1, some nondeletion alpha thalassemias have also been reported.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1510]
Molekulargewicht: 15kDa
NCBI: 3039
UniProt: P69905
Reinheit: Affinity purification
Sequenz: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK
Target-Kategorie: HBA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IF-P,1:100 - 1:400|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cardiovascular,Blood,Blood Cell Antigens,RBC Antigens. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Western blot analysis of lysates from Rat liver using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded rat spleen using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded human spleen using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded mouse spleen using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.