SRR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9325
Artikelname: SRR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9325
Hersteller Artikelnummer: A9325
Alternativnummer: ABB-A9325-100UL,ABB-A9325-20UL,ABB-A9325-1000UL,ABB-A9325-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ILV1, ISO1, SRR
Enables several functions, including L-serine ammonia-lyase activity, PDZ domain binding activity, and anion binding activity. Involved in pyruvate biosynthetic process, response to lipopolysaccharide, and serine family amino acid metabolic process. Located in cytoplasm and neuronal cell body.
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 63826
UniProt: Q9GZT4
Reinheit: Affinity purification
Sequenz: MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDL
Target-Kategorie: SRR
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag
Western blot analysis of various lysates using SRR Rabbit pAb (A9325) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.