SRR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9325
Article Name: SRR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9325
Supplier Catalog Number: A9325
Alternative Catalog Number: ABB-A9325-100UL,ABB-A9325-20UL,ABB-A9325-1000UL,ABB-A9325-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ILV1, ISO1, SRR
Enables several functions, including L-serine ammonia-lyase activity, PDZ domain binding activity, and anion binding activity. Involved in pyruvate biosynthetic process, response to lipopolysaccharide, and serine family amino acid metabolic process. Located in cytoplasm and neuronal cell body.
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 63826
UniProt: Q9GZT4
Purity: Affinity purification
Sequence: MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDL
Target: SRR
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag
Western blot analysis of various lysates using SRR Rabbit pAb (A9325) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.