DEPDC6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9447
- Bilder (1)
| Artikelname: | DEPDC6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9447 |
| Hersteller Artikelnummer: | A9447 |
| Alternativnummer: | ABB-A9447-100UL,ABB-A9447-20UL,ABB-A9447-1000UL,ABB-A9447-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DEP.6, DEPDC6 |
| Involved in several processes, including negative regulation of TOR signaling, negative regulation of cell size, and negative regulation of protein kinase activity. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 46kDa |
| NCBI: | 64798 |
| UniProt: | Q8TB45 |
| Reinheit: | Affinity purification |
| Sequenz: | MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQF |
| Target-Kategorie: | DEPTOR |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway. Shipping: Ice Bag |

