DEPDC6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9447
Article Name: DEPDC6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9447
Supplier Catalog Number: A9447
Alternative Catalog Number: ABB-A9447-100UL,ABB-A9447-20UL,ABB-A9447-1000UL,ABB-A9447-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DEP.6, DEPDC6
Involved in several processes, including negative regulation of TOR signaling, negative regulation of cell size, and negative regulation of protein kinase activity.
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 64798
UniProt: Q8TB45
Purity: Affinity purification
Sequence: MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQF
Target: DEPTOR
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using DEPDC6 Rabbit pAb (A9447) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.