SLC34A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9460
Artikelname: SLC34A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9460
Hersteller Artikelnummer: A9460
Alternativnummer: ABB-A9460-100UL,ABB-A9460-20UL,ABB-A9460-500UL,ABB-A9460-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PULAM, NPTIIb, NaPi2b, NAPI-3B, NAPI-IIb, SLC34A2
The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 76kDa
NCBI: 10568
UniProt: O95436
Reinheit: Affinity purification
Sequenz: EVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDLA
Target-Kategorie: SLC34A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLC34A2 Rabbit pAb (A9460) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.