SLC34A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9460
- Bilder (1)
| Artikelname: | SLC34A2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9460 |
| Hersteller Artikelnummer: | A9460 |
| Alternativnummer: | ABB-A9460-100UL,ABB-A9460-20UL,ABB-A9460-500UL,ABB-A9460-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PULAM, NPTIIb, NaPi2b, NAPI-3B, NAPI-IIb, SLC34A2 |
| The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 76kDa |
| NCBI: | 10568 |
| UniProt: | O95436 |
| Reinheit: | Affinity purification |
| Sequenz: | EVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDLA |
| Target-Kategorie: | SLC34A2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag |

