SLC34A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9460
Article Name: SLC34A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9460
Supplier Catalog Number: A9460
Alternative Catalog Number: ABB-A9460-100UL,ABB-A9460-20UL,ABB-A9460-500UL,ABB-A9460-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PULAM, NPTIIb, NaPi2b, NAPI-3B, NAPI-IIb, SLC34A2
The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 10568
UniProt: O95436
Purity: Affinity purification
Sequence: EVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDLA
Target: SLC34A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLC34A2 Rabbit pAb (A9460) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.