ZRANB3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9555
Artikelname: ZRANB3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9555
Hersteller Artikelnummer: A9555
Alternativnummer: ABB-A9555-100UL,ABB-A9555-20UL,ABB-A9555-500UL,ABB-A9555-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AH2, 4933425L19Rik, ZRANB3
Enables ATP-dependent DNA/DNA annealing activity, K63-linked polyubiquitin modification-dependent protein binding activity, and endodeoxyribonuclease activity. Involved in several processes, including DNA metabolic process, DNA rewinding, and negative regulation of DNA recombination. Located in nuclear replication fork and nucleoplasm.
Klonalität: Polyclonal
Molekulargewicht: 123kDa
NCBI: 84083
UniProt: Q5FWF4
Reinheit: Affinity purification
Sequenz: ITKQQTKQNCTKRYITKEDVAVASMDKVKNVGGHVRLITKESRPRDPFTKKLLEDGACVPFLNPYTVQADLTVKPSTSKGYLQAVDNEGNPLCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLRDAPKSQRKNLLYATWTSKLPLEQLNEMIRNPGEGHFWQVDHIKPVYGGGGQCSLDNLQTLCTVCHKERTARQAKERSQVRRQSLASKHGSDITR
Target-Kategorie: ZRANB3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using ZRANB3 Rabbit pAb (A9555) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.