ZRANB3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9555
Article Name: ZRANB3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9555
Supplier Catalog Number: A9555
Alternative Catalog Number: ABB-A9555-100UL,ABB-A9555-20UL,ABB-A9555-500UL,ABB-A9555-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AH2, 4933425L19Rik, ZRANB3
Enables ATP-dependent DNA/DNA annealing activity, K63-linked polyubiquitin modification-dependent protein binding activity, and endodeoxyribonuclease activity. Involved in several processes, including DNA metabolic process, DNA rewinding, and negative regulation of DNA recombination. Located in nuclear replication fork and nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 123kDa
NCBI: 84083
UniProt: Q5FWF4
Purity: Affinity purification
Sequence: ITKQQTKQNCTKRYITKEDVAVASMDKVKNVGGHVRLITKESRPRDPFTKKLLEDGACVPFLNPYTVQADLTVKPSTSKGYLQAVDNEGNPLCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLRDAPKSQRKNLLYATWTSKLPLEQLNEMIRNPGEGHFWQVDHIKPVYGGGGQCSLDNLQTLCTVCHKERTARQAKERSQVRRQSLASKHGSDITR
Target: ZRANB3
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using ZRANB3 Rabbit pAb (A9555) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.