EB3/MAPRE3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9591
- Bilder (1)
| Artikelname: | EB3/MAPRE3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9591 |
| Hersteller Artikelnummer: | A9591 |
| Alternativnummer: | ABB-A9591-20UL,ABB-A9591-100UL,ABB-A9591-1000UL,ABB-A9591-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EB3, RP3, EBF3, EBF3-S, EB3/MAPRE3 |
| The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 32kDa |
| NCBI: | 22924 |
| UniProt: | Q9UPY8 |
| Reinheit: | Affinity purification |
| Sequenz: | MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGIL |
| Target-Kategorie: | MAPRE3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell cycle inhibitors,Cytoskeleton,Microtubules. Shipping: Ice Bag |

