EB3/MAPRE3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9591
Article Name: EB3/MAPRE3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9591
Supplier Catalog Number: A9591
Alternative Catalog Number: ABB-A9591-20UL,ABB-A9591-100UL,ABB-A9591-1000UL,ABB-A9591-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: EB3, RP3, EBF3, EBF3-S, EB3/MAPRE3
The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 22924
UniProt: Q9UPY8
Purity: Affinity purification
Sequence: MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGIL
Target: MAPRE3
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell cycle inhibitors,Cytoskeleton,Microtubules. Shipping: Ice Bag
Western blot analysis of various lysates using EB3/MAPRE3 Rabbit pAb (A9591) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.