ST8SIA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9648
- Bilder (1)
| Artikelname: | ST8SIA1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9648 |
| Hersteller Artikelnummer: | A9648 |
| Alternativnummer: | ABB-A9648-20UL,ABB-A9648-100UL,ABB-A9648-1000UL,ABB-A9648-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GD3S, SIAT8, SIAT8A, SIAT8-A, ST8SiaI, ST8SIA1 |
| Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 41kDa |
| NCBI: | 6489 |
| UniProt: | Q92185 |
| Reinheit: | Affinity purification |
| Sequenz: | YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHA |
| Target-Kategorie: | ST8SIA1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:2000 - 1:9000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Endocrine Metabolism. Shipping: Ice Bag |

