ST8SIA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9648
Article Name: ST8SIA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9648
Supplier Catalog Number: A9648
Alternative Catalog Number: ABB-A9648-20UL,ABB-A9648-100UL,ABB-A9648-1000UL,ABB-A9648-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GD3S, SIAT8, SIAT8A, SIAT8-A, ST8SiaI, ST8SIA1
Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 6489
UniProt: Q92185
Purity: Affinity purification
Sequence: YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHA
Target: ST8SIA1
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:9000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse kidney, using ST8SIA1 Rabbit pAb (A9648) at 1:8000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.