EIF3K Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9969
- Bilder (1)
| Artikelname: | EIF3K Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9969 |
| Hersteller Artikelnummer: | A9969 |
| Alternativnummer: | ABB-A9969-100UL,ABB-A9969-20UL,ABB-A9969-1000UL,ABB-A9969-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | M9, ARG134, PLAC24, PTD001, EIF3S12, HSPC029, MSTP001, PLAC-24, PRO1474, EIF3-p28, EIF3K |
| The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 25kDa |
| NCBI: | 27335 |
| UniProt: | Q9UBQ5 |
| Reinheit: | Affinity purification |
| Sequenz: | MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ |
| Target-Kategorie: | EIF3K |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience. Shipping: Ice Bag |

