EIF3K Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9969
Article Name: EIF3K Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9969
Supplier Catalog Number: A9969
Alternative Catalog Number: ABB-A9969-100UL,ABB-A9969-20UL,ABB-A9969-1000UL,ABB-A9969-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: M9, ARG134, PLAC24, PTD001, EIF3S12, HSPC029, MSTP001, PLAC-24, PRO1474, EIF3-p28, EIF3K
The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 27335
UniProt: Q9UBQ5
Purity: Affinity purification
Sequence: MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Target: EIF3K
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using EIF3K Rabbit pAb (A9969) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.