FTSJ3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9994
- Bilder (1)
| Artikelname: | FTSJ3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9994 |
| Hersteller Artikelnummer: | A9994 |
| Alternativnummer: | ABB-A9994-20UL,ABB-A9994-100UL,ABB-A9994-1000UL,ABB-A9994-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SPB1, EPCS3, FTSJ3 |
| Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein possibly involved in embryogenesis. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 97kDa |
| NCBI: | 117246 |
| UniProt: | Q8IY81 |
| Reinheit: | Affinity purification |
| Sequenz: | EGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKHRILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQKKKHKRK |
| Target-Kategorie: | FTSJ3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Stem Cells,Germline Stem Cells. Shipping: Ice Bag |

