FTSJ3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9994
Article Name: FTSJ3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9994
Supplier Catalog Number: A9994
Alternative Catalog Number: ABB-A9994-20UL,ABB-A9994-100UL,ABB-A9994-1000UL,ABB-A9994-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SPB1, EPCS3, FTSJ3
Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein possibly involved in embryogenesis.
Clonality: Polyclonal
Molecular Weight: 97kDa
NCBI: 117246
UniProt: Q8IY81
Purity: Affinity purification
Sequence: EGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKHRILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQKKKHKRK
Target: FTSJ3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Stem Cells,Germline Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using FTSJ3 Rabbit pAb (A9994) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.