Actin (plant specific) Rabbit pAb, IgG1, Unconjugated

Artikelnummer: ABB-AC053
Artikelname: Actin (plant specific) Rabbit pAb, IgG1, Unconjugated
Artikelnummer: ABB-AC053
Hersteller Artikelnummer: AC053
Alternativnummer: ABB-AC053-100UL,ABB-AC053-200UL,ABB-AC053-1000UL,ABB-AC053-50UL,ABB-AC053-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: A. thaliana
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ACT12, Actin(Plant Specific)
Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Konzentration: WB
Molekulargewicht: 45kDa
Isotyp: IgG1
Reinheit: Affinity purification
Sequenz: MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP
Target-Kategorie: ACT12
Application Verdünnung: WB,1:1000 - 1:5000
Anwendungsbeschreibung: Cross-Reactivity: Widely Range,Oryza sativa. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of lysates from Oryza sativa usingplant actin Rabbit pAb (AC053) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:(ECL Basic Kit (RM00020)).
Exposure time: 180s.