Actin (plant specific) Rabbit pAb, IgG1, Unconjugated

Catalog Number: ABB-AC053
Article Name: Actin (plant specific) Rabbit pAb, IgG1, Unconjugated
Biozol Catalog Number: ABB-AC053
Supplier Catalog Number: AC053
Alternative Catalog Number: ABB-AC053-100UL,ABB-AC053-200UL,ABB-AC053-1000UL,ABB-AC053-50UL,ABB-AC053-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: A. thaliana
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ACT12, Actin(Plant Specific)
Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Concentration: WB
Molecular Weight: 45kDa
Isotype: IgG1
Purity: Affinity purification
Sequence: MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP
Target: ACT12
Application Dilute: WB,1:1000 - 1:5000
Application Notes: Cross-Reactivity: Widely Range,Oryza sativa. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of lysates from Oryza sativa usingplant actin Rabbit pAb (AC053) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:(ECL Basic Kit (RM00020)).
Exposure time: 180s.