Rabbit anti MBP-Tag pAb, Unconjugated
Artikelnummer:
ABB-AE137
- Bilder (1)
| Artikelname: | Rabbit anti MBP-Tag pAb, Unconjugated |
| Artikelnummer: | ABB-AE137 |
| Hersteller Artikelnummer: | AE137 |
| Alternativnummer: | ABB-AE137-200UL,ABB-AE137-100UL,ABB-AE137-500UL,ABB-AE137-1000UL,ABB-AE137-50UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | E. coli |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ECK4026 |
| Biofilm microarray result was validated with RT-PCR. [More information is available at EcoGene: EG10554]. In addition to being the periplasmic substrate-binding component of the maltose ABC transporter, MalE with bound substrate is also able to bind to the chemoreceptor Tar to induce chemotaxis toward maltose. |
| Konzentration: | WB |
| Molekulargewicht: | 43kDa |
| NCBI: | 948538 |
| UniProt: | P0AEX9 |
| Reinheit: | Affinity purification |
| Sequenz: | KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPS |
| Target-Kategorie: | malE |
| Application Verdünnung: | WB,1:10000 - 1:60000 |
| Anwendungsbeschreibung: | Cross-Reactivity: Species independent. Shipping: Ice Bag |

