Rabbit anti MBP-Tag pAb, Unconjugated
Catalog Number:
ABB-AE137
- Images (1)
| Article Name: | Rabbit anti MBP-Tag pAb, Unconjugated |
| Biozol Catalog Number: | ABB-AE137 |
| Supplier Catalog Number: | AE137 |
| Alternative Catalog Number: | ABB-AE137-200UL,ABB-AE137-100UL,ABB-AE137-500UL,ABB-AE137-1000UL,ABB-AE137-50UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | E. coli |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ECK4026 |
| Biofilm microarray result was validated with RT-PCR. [More information is available at EcoGene: EG10554]. In addition to being the periplasmic substrate-binding component of the maltose ABC transporter, MalE with bound substrate is also able to bind to the chemoreceptor Tar to induce chemotaxis toward maltose. |
| Concentration: | WB |
| Molecular Weight: | 43kDa |
| NCBI: | 948538 |
| UniProt: | P0AEX9 |
| Purity: | Affinity purification |
| Sequence: | KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPS |
| Target: | malE |
| Application Dilute: | WB,1:10000 - 1:60000 |
| Application Notes: | Cross-Reactivity: Species independent. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and 293F cells transfected with MBP Tag using Rabbit anti MBP Tag pAb (AE137) at 1:10000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020) .Exposure time: 10s. |
Product Guarantee and Expert Support
