Recombinant Human TNFRSF25/DR3 Protein

Artikelnummer: ABB-RP00464
Artikelname: Recombinant Human TNFRSF25/DR3 Protein
Artikelnummer: ABB-RP00464
Hersteller Artikelnummer: RP00464
Alternativnummer: ABB-RP00464-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Gln199
Alternative Synonym: TNFRSF25,APO-3,DDR3,DR3,LARD,TNFRSF12,TR3,TRAMP,WSL-1,WSL-LR
Recombinant Human TNFRSF25/DR3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gln199) of human TNFRSF25/DR3 (Accession Q93038) fused with a hFc tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 45.9 kDa
Tag: C-hFc
NCBI: 8718
UniProt: Q93038
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequenz: MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
Target-Kategorie: TNFRSF25
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Immune Checkpoint,TNF family. Shipping: Ice Bag
Recombinant Human TNFRSF25/DR3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.