Recombinant Human TNFRSF25/DR3 Protein

Catalog Number: ABB-RP00464
Article Name: Recombinant Human TNFRSF25/DR3 Protein
Biozol Catalog Number: ABB-RP00464
Supplier Catalog Number: RP00464
Alternative Catalog Number: ABB-RP00464-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Gln199
Alternative Names: TNFRSF25,APO-3,DDR3,DR3,LARD,TNFRSF12,TR3,TRAMP,WSL-1,WSL-LR
Recombinant Human TNFRSF25/DR3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gln199) of human TNFRSF25/DR3 (Accession Q93038) fused with a hFc tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 45.9 kDa
Tag: C-hFc
NCBI: 8718
UniProt: Q93038
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
Target: TNFRSF25
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Immune Checkpoint,TNF family. Shipping: Ice Bag
Recombinant Human TNFRSF25/DR3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.