Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein

Artikelnummer: ABB-RP01129
Artikelname: Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein
Artikelnummer: ABB-RP01129
Hersteller Artikelnummer: RP01129
Alternativnummer: ABB-RP01129-50UG,ABB-RP01129-20UG,ABB-RP01129-10UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Gln39-Pro193
Alternative Synonym: CD70,CD27L, LPFS3, CD27-L, CD27LG, TNFSF7, TNLG8A,CD27-L,CD27LG,TNFSF7,TNLG8A
Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln39-Pro193) of human CD70 (Accession NP_001243.1) fused with an Fc tag at the N-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 43.09 kDa
Tag: N-hFc
NCBI: 970
UniProt: P32970
Quelle: HEK293 cells
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution PBS, pH 7.4.Contact us for customized product form or formulation.
Sequenz: QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Target-Kategorie: TNFSF7/CD27 Ligand
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution PBS, pH 7.4.Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Immune Checkpoint,CAR-T Cell Therapy Targets,Bio-Markers & CD Antigens,TNF family,Biosimilar Drug Targets. Shipping: Ice Bag
Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.