Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein

Catalog Number: ABB-RP01129
Article Name: Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein
Biozol Catalog Number: ABB-RP01129
Supplier Catalog Number: RP01129
Alternative Catalog Number: ABB-RP01129-50UG,ABB-RP01129-20UG,ABB-RP01129-10UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Gln39-Pro193
Alternative Names: CD70,CD27L, LPFS3, CD27-L, CD27LG, TNFSF7, TNLG8A,CD27-L,CD27LG,TNFSF7,TNLG8A
Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln39-Pro193) of human CD70 (Accession NP_001243.1) fused with an Fc tag at the N-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 43.09 kDa
Tag: N-hFc
NCBI: 970
UniProt: P32970
Source: HEK293 cells
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution PBS, pH 7.4.Contact us for customized product form or formulation.
Sequence: QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Target: TNFSF7/CD27 Ligand
Application Dilute: Lyophilized from a 0.22 µm filtered solution PBS, pH 7.4.Contact us for customized product form or formulation.
Application Notes: ResearchArea: Immune Checkpoint,CAR-T Cell Therapy Targets,Bio-Markers & CD Antigens,TNF family,Biosimilar Drug Targets. Shipping: Ice Bag
Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.